General Information

  • ID:  hor005491
  • Uniprot ID:  P06884
  • Protein name:  Pancreatic icosapeptide
  • Gene name:  PPY
  • Organism:  Felis catus (Cat) (Felis silvestris catus)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  Released from the major endocrine cell type of the duodenal pancreas
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Felis (genus), Felinae (subfamily), Felidae (family), Feliformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DRGETLDILEWGSPHAAAPR
  • Length:  20(40-59)
  • Propeptide:  APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRYGKRDRGETLDILEWGSPHAAAPRELSPMDV
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.; The physiological role for the icosapeptide has not yet been elucidated.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P06884-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005491_AF2.pdbhor005491_ESM.pdb

Physical Information

Mass: 253048 Formula: C95H147N29O31
Absent amino acids: CFKMNQVY Common amino acids: A
pI: 4.54 Basic residues: 3
Polar residues: 4 Hydrophobic residues: 7
Hydrophobicity: -75.5 Boman Index: -4713
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 73.5
Instability Index: 2247.5 Extinction Coefficient cystines: 5500
Absorbance 280nm: 289.47

Literature

  • PubMed ID:  3827854
  • Title:  Cat pancreatic eicosapeptide and its biosynthetic intermediate. Conservation of a monobasic processing site.